This peptide is a known endogenous MC3R and MC4R antagonist and a powerful orexigenic peptide when infused centrally. It increases cortisol release and inhibits pulsatile LH release in monkey. AGRP, like NPY, may mediate the effect of a negative energy ba

H – Ser – Ser – Arg – Arg – Cys – Val – Arg – Leu – His – Glu – Ser – Cys – Leu – Gly – Gln – Gln – Val – Pro – Cys – Cys – Asp – Pro – Cys – Ala – Thr – Cys – Tyr – Cys – Arg – Phe – Phe – Asn – Ala – Phe – Cys – Tyr – Cys – Arg – Lys – Leu – Gly – Thr –

≥ 95%

-20°C

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT – NH2 (5 disulfide bridges)

Ref: Vulliemoz, NR. et al. Endocrinol. 146, 784 (2005); Langouche, L. et al. J. Neuroendocrinol. 16, 695 (2004); Yang, Y. et al. Mol. Endocrinol. 13, 148 (1999).