This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. This sequence is biotinylated through the LC spacer on the N-terminus. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor.

Biotin – LC – Gly – Ser – Arg – Ala – His – Ser – Ser – His – Leu – Lys – Ser – Lys – Lys – Gly – Gln – Ser – Thr – Ser – Arg – His – Lys – Lys – Leu – Met – Phe – Lys – Thr – Glu – Gly – Pro – Asp – Ser – Asp – NH2

≥ 95%

-20°C

Biotin – LC – GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD – NH2