This peptide is derived from apolipoprotein E (apoE) residues 131-169. ApoE is primarily synthesized by the liver but can also be found in the spleen, kidney, adrenals, gonads, and brain. It is a ligand for low-density lipoprotein receptors and is involve

H – Gly – Arg – Leu – Val – Gln – Tyr – Arg – Gly – Glu – Val – Gln – Ala – Met – Leu – Gly – Gln – Ser – Thr – Glu – Glu – Leu – Arg – Val – Arg – Leu – Ala – Ser – His – Leu – Arg – Lys – Leu – Arg – Lys – Arg – Leu – Leu – Arg – Asp – OH

≥ 95%

-20°C

GRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD

Davignon, J. et al. Arterioscler Thromb Vasc Biol 8, 1 (1988); Mahley, RW. Science 240, 622 (1988).